PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G204500.1
Common NamePHAVU_008G204500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YC
Protein Properties Length: 278aa    MW: 31081.6 Da    PI: 5.0604
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G204500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC60.34.1e-196861898
               NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                        ++++P arikki++adedv +i+  +P l+ska elf+ +l  r++  +     +t++   ++++v+  ++fdfl div +
  Phvul.008G204500.1  6 DTRFPAARIKKIMQADEDVGKIAMAVPLLVSKALELFLQDLCDRTYEITLRRGAKTMNAFHLKQCVQTFNVFDFLKDIVSK 86
                        5789**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.0E-26372IPR009072Histone-fold
SuperFamilySSF471136.2E-20488IPR009072Histone-fold
PfamPF008082.3E-18871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIAMA VPLLVSKALE LFLQDLCDRT YEITLRRGAK  60
TMNAFHLKQC VQTFNVFDFL KDIVSKVPDL GGSVANGDDH TVKRRKVAED DNDSHEEPKR  120
SNRAEPGHTG GRGRGRGRGR GRGRGIRNVD QEMSSHAKCE EDSDALKQNE KQTQSNESME  180
HVSSPEEVKQ TLPVSKPAQV SIRNFDLNMD PDENMDLVAS PTPVPSSSSA KSISEEKHDE  240
YPGWSLSDME KMTIDPIQLA NINGRIDEDE EDYDEEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133143RGRGRGRGRGR
2135144RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141534.10.0hypothetical protein PHAVU_008G204500g
TrEMBLV7B9I40.0V7B9I4_PHAVU; Uncharacterized protein
STRINGGLYMA02G44500.21e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.15e-62nuclear factor Y, subunit C11